PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AL_41B71F83C.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 284aa    MW: 30437.1 Da    PI: 7.5037
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AL_41B71F83C.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.3e-171562148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEd+llvd+v+   +g+W+  ++  g++R++k+c++rw +yl
  Traes_2AL_41B71F83C.1 15 KGPWTPEEDKLLVDYVQANAPGNWRMLPKLAGLNRCGKSCRLRWTNYL 62
                           79********************************************97 PP

2Myb_DNA-binding521.6e-1668112147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg++T+eE++ ++++++  G++ W+ Ia+ ++ gRt++++k++w++ 
  Traes_2AL_41B71F83C.1  68 RGPFTAEEHKSILQLHAIVGNK-WSMIAAQLP-GRTDNEIKNYWNTN 112
                            89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.5911062IPR017930Myb domain
SuperFamilySSF466894.77E-3112109IPR009057Homeodomain-like
SMARTSM007179.5E-131464IPR001005SANT/Myb domain
PfamPF002491.0E-141562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-231669IPR009057Homeodomain-like
CDDcd001671.27E-91762No hitNo description
PROSITE profilePS5129425.5163117IPR017930Myb domain
SMARTSM007179.1E-1567115IPR001005SANT/Myb domain
PfamPF002492.1E-1468113IPR001005SANT/Myb domain
CDDcd001675.04E-1170113No hitNo description
Gene3DG3DSA:1.10.10.608.0E-2670117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MGRTPCCESR QGLKKGPWTP EEDKLLVDYV QANAPGNWRM LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGP FTAEEHKSIL QLHAIVGNKW SMIAAQLPGR TDNEIKNYWN TNLKKQLRQA  120
ALVGEQHPAL ASPGASVGAG CLAARHTAQW ETARLEAEAR LSMLSTSAAT TSVTASSSSS  180
TAAAGGEHGA DAPSDVFLRL WNSEVGDTFR RKSAGSAPRE GSAQPAAAPL PPPGDDSSAA  240
SNVTTAVTAE EYQVFLDMAA EELGLFHGGF SLYPQADGLF AEFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-281311725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1086211e-138AK108621.1 Oryza sativa Japonica Group cDNA clone:002-147-D04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006653621.11e-127PREDICTED: myb-related protein Myb4-like
TrEMBLW5ARK20.0W5ARK2_WHEAT; Uncharacterized protein
STRINGMLOC_68698.11e-162(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54093157
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.12e-78myb domain protein 17
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]